Lineage for d1rkea2 (1rke A:129-258)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 353428Fold a.24: Four-helical up-and-down bundle [47161] (20 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 353591Superfamily a.24.9: alpha-catenin/vinculin [47220] (1 family) (S)
  5. 353592Family a.24.9.1: alpha-catenin/vinculin [47221] (2 proteins)
    possible duplication: contains several domains of this fold
    The listed PDB entries contain different large fragments but not the whole proteins
  6. 353608Protein Vinculin [47224] (2 species)
  7. 353612Species Human (Homo sapiens) [TaxId:9606] [101111] (2 PDB entries)
  8. 353614Domain d1rkea2: 1rke A:129-258 [97609]
    head domain; contains two domains of this fold; complexed with separate tail domain of the same or closely related protein

Details for d1rkea2

PDB Entry: 1rke (more details), 2.35 Å

PDB Description: Human vinculin head (1-258) in complex with human vinculin tail (879-1066)

SCOP Domain Sequences for d1rkea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rkea2 a.24.9.1 (A:129-258) Vinculin {Human (Homo sapiens)}
aevrkiirvckgileyltvaevvetmedlvtytknlgpgmtkmakmiderqqelthqehr
vmlvnsmntvkellpvlisamkifvttknsknqgieealknrnftvekmsaeineiirvl
qltswdedaw

SCOP Domain Coordinates for d1rkea2:

Click to download the PDB-style file with coordinates for d1rkea2.
(The format of our PDB-style files is described here.)

Timeline for d1rkea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rkea1
View in 3D
Domains from other chains:
(mouse over for more information)
d1rkeb_