SCOP 1.67: Domain d1rkea1: 1rke A:-3-128

Lineage for d1rkea1 (1rke A:-3-128)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (20 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.9: alpha-catenin/vinculin [47220] (1 family)

5. Family a.24.9.1: alpha-catenin/vinculin [47221] (2 proteins)
   possible duplication: contains several domains of this fold
   The listed PDB entries contain different large fragments but not the whole proteins

6. Protein Vinculin [47224] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101111] (2 PDB entries)

8. Domain d1rkea1: 1rke A:-3-128 [97608]

Details for d1rkea1

PDB Entry: 1rke, 2.35 Å

PDB Description: Human vinculin head (1-258) in complex with human vinculin tail (879-1066)

SCOP Domain Sequences for d1rkea1:

Sequence; same for both SEQRES and ATOM records:

>d1rkea1 a.24.9.1 (A:-3-128) Vinculin {Human (Homo sapiens)}
hhhhmpvfhtrtiesilepvaqqishlvimheegevdgkaipdltapvaavqaavsnlvr
vgketvqttedqilkrdmppafikvenactklvqaaqmlqsdpysvpardylidgsrgil
sgtsdllltfde

Timeline for d1rkea1:

• d1rkea1 is new in SCOP 1.67
  
• d1rkea1 appears in SCOP 1.69
  
• d1rkea1 appears in the current release, SCOPe 2.08