![]() | Class a: All alpha proteins [46456] (218 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (23 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.9: alpha-catenin/vinculin [47220] (1 family) ![]() |
![]() | Family a.24.9.1: alpha-catenin/vinculin [47221] (2 proteins) possible duplication: contains several domains of this fold The listed PDB entries contain different large fragments but not the whole proteins |
![]() | Protein Vinculin [47224] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [101111] (3 PDB entries) |
![]() | Domain d1rkea2: 1rke A:129-258 [97609] head domain; contains two domains of this fold; complexed with separate tail domain of the same or closely related protein |
PDB Entry: 1rke (more details), 2.35 Å
SCOP Domain Sequences for d1rkea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rkea2 a.24.9.1 (A:129-258) Vinculin {Human (Homo sapiens)} aevrkiirvckgileyltvaevvetmedlvtytknlgpgmtkmakmiderqqelthqehr vmlvnsmntvkellpvlisamkifvttknsknqgieealknrnftvekmsaeineiirvl qltswdedaw
Timeline for d1rkea2: