Lineage for d1rg9a1 (1rg9 A:1-102)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2976292Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 2976293Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 2976294Family d.130.1.1: S-adenosylmethionine synthetase [55974] (2 proteins)
  6. 2976295Protein S-adenosylmethionine synthetase [55975] (3 species)
    synonym: methionine adenosyltransferase, MAT
  7. 2976296Species Escherichia coli [TaxId:562] [55976] (9 PDB entries)
  8. 2976315Domain d1rg9a1: 1rg9 A:1-102 [97427]
    complexed with k, mg, ppk, sam

Details for d1rg9a1

PDB Entry: 1rg9 (more details), 2.5 Å

PDB Description: s-adenosylmethionine synthetase complexed with sam and ppnp
PDB Compounds: (A:) s-adenosylmethionine synthetase

SCOPe Domain Sequences for d1rg9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rg9a1 d.130.1.1 (A:1-102) S-adenosylmethionine synthetase {Escherichia coli [TaxId: 562]}
akhlftsesvseghpdkiadqisdavldaileqdpkarvacetyvktgmvlvggeittsa
wvdieeitrntvreigyvhsdmgfdanscavlsaigkqspdi

SCOPe Domain Coordinates for d1rg9a1:

Click to download the PDB-style file with coordinates for d1rg9a1.
(The format of our PDB-style files is described here.)

Timeline for d1rg9a1: