PDB entry 1rg9

View 1rg9 on RCSB PDB site
Description: S-Adenosylmethionine synthetase complexed with SAM and PPNP
Class: transferase
Keywords: S-adenosylmethionine synthetase; methionine adenosyltransferase, TRANSFERASE
Deposited on 2003-11-11, released 2004-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: s-adenosylmethionine synthetase
    Species: Escherichia coli [TaxId:562]
    Gene: METK, METX, B2942, C3528, Z4287, ECS3818, SF2933, S3137
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rg9a1, d1rg9a2, d1rg9a3
  • Chain 'B':
    Compound: s-adenosylmethionine synthetase
    Species: Escherichia coli [TaxId:562]
    Gene: METK, METX, B2942, C3528, Z4287, ECS3818, SF2933, S3137
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rg9b1, d1rg9b2, d1rg9b3
  • Chain 'C':
    Compound: s-adenosylmethionine synthetase
    Species: Escherichia coli [TaxId:562]
    Gene: METK, METX, B2942, C3528, Z4287, ECS3818, SF2933, S3137
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rg9c1, d1rg9c2, d1rg9c3
  • Chain 'D':
    Compound: s-adenosylmethionine synthetase
    Species: Escherichia coli [TaxId:562]
    Gene: METK, METX, B2942, C3528, Z4287, ECS3818, SF2933, S3137
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rg9d1, d1rg9d2, d1rg9d3
  • Heterogens: K, MG, SAM, PPK, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rg9A (A:)
    akhlftsesvseghpdkiadqisdavldaileqdpkarvacetyvktgmvlvggeittsa
    wvdieeitrntvreigyvhsdmgfdanscavlsaigkqspdinqgvdradpleqgagdqg
    lmfgyatnetdvlmpapityahrlvqrqaevrkngtlpwlrpdaksqvtfqyddgkivgi
    davvlstqhseeidqkslqeavmeeiikpilpaewltsatkffinptgrfviggpmgdcg
    ltgrkiivdtyggmarhgggafsgkdpskvdrsaayaaryvaknivaagladrceiqvsy
    aigvaeptsimvetfgtekvpseqltllvreffdlrpygliqmldllhpiyketaayghf
    grehfpwektdkaqllrdaaglk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rg9B (B:)
    akhlftsesvseghpdkiadqisdavldaileqdpkarvacetyvktgmvlvggeittsa
    wvdieeitrntvreigyvhsdmgfdanscavlsaigkqspdinqgvdradpleqgagdqg
    lmfgyatnetdvlmpapityahrlvqrqaevrkngtlpwlrpdaksqvtfqyddgkivgi
    davvlstqhseeidqkslqeavmeeiikpilpaewltsatkffinptgrfviggpmgdcg
    ltgrkiivdtyggmarhgggafsgkdpskvdrsaayaaryvaknivaagladrceiqvsy
    aigvaeptsimvetfgtekvpseqltllvreffdlrpygliqmldllhpiyketaayghf
    grehfpwektdkaqllrdaaglk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rg9C (C:)
    akhlftsesvseghpdkiadqisdavldaileqdpkarvacetyvktgmvlvggeittsa
    wvdieeitrntvreigyvhsdmgfdanscavlsaigkqspdinqgvdradpleqgagdqg
    lmfgyatnetdvlmpapityahrlvqrqaevrkngtlpwlrpdaksqvtfqyddgkivgi
    davvlstqhseeidqkslqeavmeeiikpilpaewltsatkffinptgrfviggpmgdcg
    ltgrkiivdtyggmarhgggafsgkdpskvdrsaayaaryvaknivaagladrceiqvsy
    aigvaeptsimvetfgtekvpseqltllvreffdlrpygliqmldllhpiyketaayghf
    grehfpwektdkaqllrdaaglk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rg9D (D:)
    akhlftsesvseghpdkiadqisdavldaileqdpkarvacetyvktgmvlvggeittsa
    wvdieeitrntvreigyvhsdmgfdanscavlsaigkqspdinqgvdradpleqgagdqg
    lmfgyatnetdvlmpapityahrlvqrqaevrkngtlpwlrpdaksqvtfqyddgkivgi
    davvlstqhseeidqkslqeavmeeiikpilpaewltsatkffinptgrfviggpmgdcg
    ltgrkiivdtyggmarhgggafsgkdpskvdrsaayaaryvaknivaagladrceiqvsy
    aigvaeptsimvetfgtekvpseqltllvreffdlrpygliqmldllhpiyketaayghf
    grehfpwektdkaqllrdaaglk