Lineage for d1os7b_ (1os7 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2815433Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2815578Family b.82.2.5: TauD/TfdA-like [75038] (5 proteins)
    automatically mapped to Pfam PF02668
  6. 2815615Protein Taurine/alpha-ketoglutarate dioxygenase TauD [75039] (2 species)
  7. 2815616Species Escherichia coli [TaxId:562] [75040] (4 PDB entries)
  8. 2815622Domain d1os7b_: 1os7 B: [93478]
    complexed with akg, fe2, tau

Details for d1os7b_

PDB Entry: 1os7 (more details), 2.5 Å

PDB Description: Crystal structure of TauD with iron, alpha-ketoglutarate and Taurine bound at pH 7.5
PDB Compounds: (B:) Alpha-Ketoglutarate-Dependent Taurine Dioxygenase

SCOPe Domain Sequences for d1os7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1os7b_ b.82.2.5 (B:) Taurine/alpha-ketoglutarate dioxygenase TauD {Escherichia coli [TaxId: 562]}
erlsitplgpyigaqisgadltrplsdnqfeqlyhavlrhqvvflrdqaitpqqqralaq
rfgelhihpvyphaegvdeiivldthndnppdndnwhtdvtfietppagailaakelpst
ggdtlwtsgiaayealsvpfrqllsglraehdfrksfpeykyrkteeehqrwreavaknp
pllhpvvrthpvsgkqalfvnegfttrivdvsekeseallsflfahitkpefqvrwrwqp
ndiaiwdnrvtqhyanadylpqrrimhratilgdkpfyra

SCOPe Domain Coordinates for d1os7b_:

Click to download the PDB-style file with coordinates for d1os7b_.
(The format of our PDB-style files is described here.)

Timeline for d1os7b_: