Lineage for d1ogpf1 (1ogp F:263-389)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765551Family b.1.18.6: Molybdenum-containing oxidoreductases-like dimerisation domain [81286] (1 protein)
    automatically mapped to Pfam PF03404
  6. 2765552Protein Sulfite oxidase, C-terminal domain [49259] (2 species)
  7. 2765564Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [101528] (1 PDB entry)
  8. 2765570Domain d1ogpf1: 1ogp F:263-389 [92937]
    Other proteins in same PDB: d1ogpa2, d1ogpb2, d1ogpc2, d1ogpd2, d1ogpe2, d1ogpf2
    complexed with cs, gol, mtq

Details for d1ogpf1

PDB Entry: 1ogp (more details), 2.6 Å

PDB Description: the crystal structure of plant sulfite oxidase provides insight into sulfite oxidation in plants and animals
PDB Compounds: (F:) sulfite oxidase

SCOPe Domain Sequences for d1ogpf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ogpf1 b.1.18.6 (F:263-389) Sulfite oxidase, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
dfpvqsaicsvedvqmvkpgkvsikgyavsgggrgiervdisldggknwveasrtqepgk
qyisehsssdkwawvlfeatidvsqtteviakavdsaanvqpenvesvwnlrgvlntswh
rvllrlg

SCOPe Domain Coordinates for d1ogpf1:

Click to download the PDB-style file with coordinates for d1ogpf1.
(The format of our PDB-style files is described here.)

Timeline for d1ogpf1: