Lineage for d1oaxl_ (1oax L:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2741614Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 2741756Species Norway rat (Rattus norvegicus) [TaxId:10116] [101504] (7 PDB entries)
  8. 2741771Domain d1oaxl_: 1oax L: [92729]
    Other proteins in same PDB: d1oaxh_, d1oaxj_
    part of IgE Fv spe-7
    complexed with anq

Details for d1oaxl_

PDB Entry: 1oax (more details), 2.66 Å

PDB Description: Fv Structure of the IgE SPE-7 in complex with acenaphthenequinone
PDB Compounds: (L:) immunoglobulin e

SCOPe Domain Sequences for d1oaxl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oaxl_ b.1.1.1 (L:) Immunoglobulin light chain lambda variable domain, VL-lambda {Norway rat (Rattus norvegicus) [TaxId: 10116]}
avvtqesalttspgetvtltcrsstgavttsnyanwvqekprhlftgliggtnnrapgvp
arfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvl

SCOPe Domain Coordinates for d1oaxl_:

Click to download the PDB-style file with coordinates for d1oaxl_.
(The format of our PDB-style files is described here.)

Timeline for d1oaxl_: