Lineage for d1l2fa1 (1l2f A:127-198)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789672Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins)
    barrel, closed; n=5, S=8
  6. 2790101Protein S1 domain of NusA [69265] (2 species)
  7. 2790108Species Thermotoga maritima [TaxId:2336] [69266] (2 PDB entries)
  8. 2790110Domain d1l2fa1: 1l2f A:127-198 [91044]
    Other proteins in same PDB: d1l2fa2, d1l2fa3, d1l2fa4

Details for d1l2fa1

PDB Entry: 1l2f (more details), 2.5 Å

PDB Description: Crystal structure of NusA from Thermotoga maritima: a structure-based role of the N-terminal domain
PDB Compounds: (A:) n utilization substance protein a

SCOPe Domain Sequences for d1l2fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l2fa1 b.40.4.5 (A:127-198) S1 domain of NusA {Thermotoga maritima [TaxId: 2336]}
fekyselkgtvttaevirvmgewadirigkletrlpkkewipgeeikagdlvkvyiidvv
kttkgpkilvsr

SCOPe Domain Coordinates for d1l2fa1:

Click to download the PDB-style file with coordinates for d1l2fa1.
(The format of our PDB-style files is described here.)

Timeline for d1l2fa1: