Lineage for d1nzcc_ (1nzc C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2814471Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2814472Family b.82.1.1: dTDP-sugar isomerase [51183] (5 proteins)
  6. 2814473Protein dTDP-4-dehydrorhamnose 3,5-epimerase RmlC [51184] (6 species)
    synonym: dTDP-6-deoxy-D-xylo-4-hexulose 3,5-epimerase
  7. 2814499Species Streptococcus suis [TaxId:1307] [89402] (4 PDB entries)
  8. 2814510Domain d1nzcc_: 1nzc C: [86447]
    complexed with ni, tdx

Details for d1nzcc_

PDB Entry: 1nzc (more details), 1.8 Å

PDB Description: The high resolution structures of RmlC from Streptococcus suis in complex with dTDP-D-xylose
PDB Compounds: (C:) dtdp-6-deoxy-d-xylo-4-hexulose 3,5-epimerase

SCOPe Domain Sequences for d1nzcc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nzcc_ b.82.1.1 (C:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Streptococcus suis [TaxId: 1307]}
nffgktlaarpveaipgmlefdipvhgdnrgwfkenfqkekmlplgfpesffaegklqnn
vsfsrknvlrglhaepwdkyisvadggkvlgtwvdlregetfgntyqtvidasksifvpr
gvangfqvlsdfvaysylvndywalelkpkyafvnyadpsldikwenleeaevseadenh
pflkdvkplrkedl

SCOPe Domain Coordinates for d1nzcc_:

Click to download the PDB-style file with coordinates for d1nzcc_.
(The format of our PDB-style files is described here.)

Timeline for d1nzcc_: