Lineage for d1nuga1 (1nug A:1-140)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 937486Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 938010Family b.1.18.9: Transglutaminase N-terminal domain [81289] (1 protein)
  6. 938011Protein Transglutaminase N-terminal domain [49235] (4 species)
    elaborated with many loop insertions in the common fold
  7. 938029Species Human (Homo sapiens), TGase E3 [TaxId:9606] [74845] (5 PDB entries)
  8. 938034Domain d1nuga1: 1nug A:1-140 [86186]
    Other proteins in same PDB: d1nuga2, d1nuga3, d1nuga4, d1nugb2, d1nugb3, d1nugb4
    complexed with ca, cl, mg

Details for d1nuga1

PDB Entry: 1nug (more details), 2.4 Å

PDB Description: role of calcium ions in the activation and activity of the transglutaminase 3 enzyme (2 calciums, 1 mg, inactive form)
PDB Compounds: (A:) Protein-glutamine glutamyltransferase E

SCOPe Domain Sequences for d1nuga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nuga1 b.1.18.9 (A:1-140) Transglutaminase N-terminal domain {Human (Homo sapiens), TGase E3 [TaxId: 9606]}
aalgvqsinwqtafnrqahhtdkfssqelilrrgqnfqvlmimnkglgsnerlefivstg
pypsesamtkavfplsngssggwsavlqasngntltisisspasapigrytmalqifsqg
gissvklgtfillfnpwlnv

SCOPe Domain Coordinates for d1nuga1:

Click to download the PDB-style file with coordinates for d1nuga1.
(The format of our PDB-style files is described here.)

Timeline for d1nuga1: