| Root: SCOPe 2.08 |
| Class b: All beta proteins [48724] (180 folds) |
| Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.5: p53-like transcription factors [49417] (8 families) ![]() |
| Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins) automatically mapped to Pfam PF00554 |
| Protein p65 subunit of NF-kappa B (NFKB), N-terminal domain [49428] (3 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [49429] (9 PDB entries) |
| Domain d1leia2: 1lei A:20-191 [84600] Other proteins in same PDB: d1leia1, d1leia3, d1leib1, d1leib2 protein/DNA complex |
PDB Entry: 1lei (more details), 2.7 Å
SCOPe Domain Sequences for d1leia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1leia2 b.2.5.3 (A:20-191) p65 subunit of NF-kappa B (NFKB), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
yveiieqpkqrgmrfrykcegrsagsipgerstdttkthptikingytgpgtvrislvtk
dpphrphphelvgkdcrdgyyeadlcpdrsihsfqnlgiqcvkkrdleqaisqriqtnnn
pfhvpieeqrgdydlnavrlcfqvtvrdpagrpllltpvlshpifdnrapnt
Timeline for d1leia2: