Lineage for d1ayn.1 (1ayn 4:,2:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2086376Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2086604Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2086605Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
    the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
    there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)
  6. 2086723Protein Rhinovirus coat proteins [49670] (5 species)
  7. 2086724Species Human rhinovirus 16, (HRV-16) [TaxId:31708] [49672] (9 PDB entries)
  8. 2086746Domain d1ayn.1: 1ayn 4:,2: [83037]
    complexed with dao, myr, zn

Details for d1ayn.1

PDB Entry: 1ayn (more details), 2.9 Å

PDB Description: human rhinovirus 16 coat protein
PDB Compounds: (2:) human rhinovirus 16 coat protein, (4:) human rhinovirus 16 coat protein

SCOPe Domain Sequences for d1ayn.1:

Sequence, based on SEQRES records: (download)

>g1ayn.1 b.121.4.1 (4:,2:) Rhinovirus coat proteins {Human rhinovirus 16, (HRV-16) [TaxId: 31708]}
gaqvsrqnvgthstqnmvsngsslnyfninyfkdaassgasrldXsdriiqitrgdstit
sqdvanavvgygvwphyltpqdataidkptqpdtssnrfytldskmwnstskgwwwklpd
alkdmgifgenmfyhflgrsgytvhvqcnaskfhqgtllvvmipehqlatvnkgnvnagy
kythpgeagrevgtqvenekqpsddnwlnfdgtllgnllifphqfinlrsnnsatlivpy
vnavpmdsmvrhnnwslviipvcqlqsnnisnivpitvsispmcaefsgaraktvvq

Sequence, based on observed residues (ATOM records): (download)

>g1ayn.1 b.121.4.1 (4:,2:) Rhinovirus coat proteins {Human rhinovirus 16, (HRV-16) [TaxId: 31708]}
gaqvsrqslnyfninyfkdaassgasrldXsdriiqitrgdstitsqdvanavvgygvwp
hyltpqdataidkptqpdtssnrfytldskmwnstskgwwwklpdalkdmgifgenmfyh
flgrsgytvhvqcnaskfhqgtllvvmipehqlatvnkgnvnagykythpgeagrevgtq
venekqpsddnwlnfdgtllgnllifphqfinlrsnnsatlivpyvnavpmdsmvrhnnw
slviipvcqlqsnnisnivpitvsispmcaefsgaraktvvq

SCOPe Domain Coordinates for d1ayn.1:

Click to download the PDB-style file with coordinates for d1ayn.1.
(The format of our PDB-style files is described here.)

Timeline for d1ayn.1: