![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.69.4: WD40 repeat-like [50978] (4 families) ![]() also contains 8-bladed propellers |
![]() | Family b.69.4.1: WD40-repeat [50979] (17 proteins) this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain |
![]() | Protein Cdc4 propeller domain [82169] (1 species) 8-bladed beta-propeller without perfect 8-fold symmetry |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82170] (2 PDB entries) |
![]() | Domain d1nexd2: 1nex D:370-744 [80448] Other proteins in same PDB: d1nexa1, d1nexa2, d1nexb1, d1nexc1, d1nexc2, d1nexd1 applies to all domains of a family if the common domain is composed of a different number of small repeating units |
PDB Entry: 1nex (more details), 2.7 Å
SCOPe Domain Sequences for d1nexd2:
Sequence, based on SEQRES records: (download)
>d1nexd2 b.69.4.1 (D:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} fvpqrttlrghmtsvitclqfednyvitgaddkmirvydsinkkfllqlsghdggvwalk yahggilvsgstdrtvrvwdikkgccthvfeghnstvrcldiveyknikyivtgsrdntl hvwklpkessvpdhgeehdyplvfhtpeenpyfvgvlrghmasvrtvsghgnivvsgsyd ntlivwdvaqmkclyilsghtdriystiydherkrcisasmdttiriwdlengelmytlq ghtalvgllrlsdkflvsaaadgsirgwdandysrkfsyhhtnlsaittfyvsdnilvsg senqfniynlrsgklvhanilkdadqiwsvnfkgktlvaavekdgqsfleildfs
>d1nexd2 b.69.4.1 (D:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} fvpqrttlrghmtsvitclqfednyvitgaddkmirvydsinkkfllqlsghdggvwalk yahggilvsgstdrtvrvwdikkgccthvfeghnstvrcldiveyknikyivtgsrdntl hvwklpkdyplvfhtpeenpyfvgvlrghmasvrtvsghgnivvsgsydntlivwdvaqm kclyilsghtdriystiydherkrcisasmdttiriwdlengelmytlqghtalvgllrl sdkflvsaaadgsirgwdandysrkfsyhhtnlsaittfyvsdnilvsgsenqfniynlr sgklvhanilkdadqiwsvnfkgktlvaavekdgqsfleildfs
Timeline for d1nexd2: