SCOPe 2.08: Domain d1nexc2: 1nex C:4-103

Lineage for d1nexc2 (1nex C:4-103)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)

6. Protein Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D [82639] (1 species)
   Suppressor of kinetochore protein 1,Scskp1

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82640] (2 PDB entries)

8. Domain d1nexc2: 1nex C:4-103 [80446]
   Other proteins in same PDB: d1nexa1, d1nexb1, d1nexb2, d1nexc1, d1nexd1, d1nexd2
   missing some secondary structures that made up less than one-third of the common domain

Details for d1nexc2

PDB Entry: 1nex, 2.7 Å

PDB Description: crystal structure of scskp1-sccdc4-cpd peptide complex

PDB Compounds: (C:) Centromere DNA-binding protein complex CBF3 subunit D

SCOPe Domain Sequences for d1nexc2:

Sequence, based on SEQRES records:

>d1nexc2 d.42.1.1 (C:4-103) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
snvvlvsgegerftvdkkiaerslllknylndmgddddedddeivmpvpnvrssvlqkvi
ewaehhrdsnfp

Sequence, based on observed residues (ATOM records):

>d1nexc2 d.42.1.1 (C:4-103) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
snvvlvsgegerftvdkkiaerslllknylivmpvpnvrssvlqkviewaehhrdsnfp

Timeline for d1nexc2:

• d1nexc2 first appeared in SCOP 1.63
  
• d1nexc2 appears in SCOPe 2.07