Lineage for d1n6dd1 (1n6d D:763-853)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2395482Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2395483Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2396008Family b.36.1.3: Tail specific protease PDZ domain [68933] (2 proteins)
  6. 2396015Protein Tricorn protease [69253] (1 species)
  7. 2396016Species Thermoplasma acidophilum [TaxId:2303] [69254] (4 PDB entries)
  8. 2396038Domain d1n6dd1: 1n6d D:763-853 [80137]
    Other proteins in same PDB: d1n6da2, d1n6da3, d1n6da4, d1n6db2, d1n6db3, d1n6db4, d1n6dc2, d1n6dc3, d1n6dc4, d1n6dd2, d1n6dd3, d1n6dd4, d1n6de2, d1n6de3, d1n6de4, d1n6df2, d1n6df3, d1n6df4
    complexed with chm, d10

Details for d1n6dd1

PDB Entry: 1n6d (more details), 2.8 Å

PDB Description: Tricorn protease in complex with tetrapeptide chloromethyl ketone derivative
PDB Compounds: (D:) tricorn protease

SCOPe Domain Sequences for d1n6dd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n6dd1 b.36.1.3 (D:763-853) Tricorn protease {Thermoplasma acidophilum [TaxId: 2303]}
griacdfkldgdhyvvakayagdysnegekspifeygidptgyliedidgetvgagsniy
rvlsekagtsarirlsgkggdkrdlmidild

SCOPe Domain Coordinates for d1n6dd1:

Click to download the PDB-style file with coordinates for d1n6dd1.
(The format of our PDB-style files is described here.)

Timeline for d1n6dd1: