Lineage for d1n6da4 (1n6d A:680-762,A:854-1061)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460576Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2460577Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2461308Family c.14.1.2: Tail specific protease, catalytic domain [52100] (3 proteins)
    includes N-terminal all-alpha subdomain
  6. 2461318Protein Tricorn protease [69436] (1 species)
  7. 2461319Species Thermoplasma acidophilum [TaxId:2303] [69437] (4 PDB entries)
  8. 2461338Domain d1n6da4: 1n6d A:680-762,A:854-1061 [80128]
    Other proteins in same PDB: d1n6da1, d1n6da2, d1n6da3, d1n6db1, d1n6db2, d1n6db3, d1n6dc1, d1n6dc2, d1n6dc3, d1n6dd1, d1n6dd2, d1n6dd3, d1n6de1, d1n6de2, d1n6de3, d1n6df1, d1n6df2, d1n6df3
    complexed with chm, d10

Details for d1n6da4

PDB Entry: 1n6d (more details), 2.8 Å

PDB Description: Tricorn protease in complex with tetrapeptide chloromethyl ketone derivative
PDB Compounds: (A:) tricorn protease

SCOPe Domain Sequences for d1n6da4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n6da4 c.14.1.2 (A:680-762,A:854-1061) Tricorn protease {Thermoplasma acidophilum [TaxId: 2303]}
ssiheeflqmydeawklardnywneavakeiseriyekyrnlvplcktrydlsnvivemq
geyrtshsyemggtftdkdpfrsXddrfiryrswveanrryvherskgtigyihipdmgm
mglnefyrlfinessyqglivdvrfngggfvsqliieklmnkrigydnprrgtlspyptn
svrgkiiaitneyagsdgdifsfsfkklglgkligtrtwggvvgitpkrrlidgtvltqp
efafwfrdagfgvenygvdpdveieyaphdylsgkdpqidyaidalieelrn

SCOPe Domain Coordinates for d1n6da4:

Click to download the PDB-style file with coordinates for d1n6da4.
(The format of our PDB-style files is described here.)

Timeline for d1n6da4: