Lineage for d1n6da2 (1n6d A:39-319)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2417088Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2418005Superfamily b.68.7: Tricorn protease N-terminal domain [69304] (1 family) (S)
    possibly related to the second domain of tricorn protease (a distorted 7-bladed beta-propeller)
  5. 2418006Family b.68.7.1: Tricorn protease N-terminal domain [69305] (1 protein)
  6. 2418007Protein Tricorn protease N-terminal domain [69306] (1 species)
  7. 2418008Species Thermoplasma acidophilum [TaxId:2303] [69307] (4 PDB entries)
  8. 2418027Domain d1n6da2: 1n6d A:39-319 [80126]
    Other proteins in same PDB: d1n6da1, d1n6da3, d1n6da4, d1n6db1, d1n6db3, d1n6db4, d1n6dc1, d1n6dc3, d1n6dc4, d1n6dd1, d1n6dd3, d1n6dd4, d1n6de1, d1n6de3, d1n6de4, d1n6df1, d1n6df3, d1n6df4
    complexed with chm, d10

Details for d1n6da2

PDB Entry: 1n6d (more details), 2.8 Å

PDB Description: Tricorn protease in complex with tetrapeptide chloromethyl ketone derivative
PDB Compounds: (A:) tricorn protease

SCOPe Domain Sequences for d1n6da2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n6da2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Thermoplasma acidophilum [TaxId: 2303]}
mpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarffpdgrkiairvm
rgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnliistdamqpfss
mtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyrggtrgkiwievn
sgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrkhtsftdyyprhl
ntdgrrilfskggsiyifnpdtekiekieigdlespedrii

SCOPe Domain Coordinates for d1n6da2:

Click to download the PDB-style file with coordinates for d1n6da2.
(The format of our PDB-style files is described here.)

Timeline for d1n6da2: