![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.69.9: Tricorn protease domain 2 [69322] (1 family) ![]() distorted 7-bladed beta-propeller fold; possibly related to the N-terminal domain of tricorn protease (a 6-bladed beta-propeller) |
![]() | Family b.69.9.1: Tricorn protease domain 2 [69323] (1 protein) |
![]() | Protein Tricorn protease domain 2 [69324] (1 species) |
![]() | Species Thermoplasma acidophilum [TaxId:2303] [69325] (4 PDB entries) |
![]() | Domain d1n6db3: 1n6d B:320-679 [80131] Other proteins in same PDB: d1n6da1, d1n6da2, d1n6da4, d1n6db1, d1n6db2, d1n6db4, d1n6dc1, d1n6dc2, d1n6dc4, d1n6dd1, d1n6dd2, d1n6dd4, d1n6de1, d1n6de2, d1n6de4, d1n6df1, d1n6df2, d1n6df4 complexed with chm, d10 |
PDB Entry: 1n6d (more details), 2.8 Å
SCOPe Domain Sequences for d1n6db3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n6db3 b.69.9.1 (B:320-679) Tricorn protease domain 2 {Thermoplasma acidophilum [TaxId: 2303]} sipskfaedfspldgdliafvsrgqafiqdvsgtyvlkvpeplriryvrrggdtkvafih gtregdflgiydyrtgkaekfeenlgnvfamgvdrngkfavvandrfeimtvdletgkpt viersreamitdftisdnsrfiaygfplkhgetdgyvmqaihvydmegrkifaattensh dyapafdadsknlyylsyrsldpspdrvvlnfsfevvskpfviplipgspnptklvprsm tseageydlndmykrsspinvdpgdyrmiiplessiliysvpvhgefaayyqgapekgvl lkydvktrkvtevknnltdlrlsadrktvmvrkddgkiytfplekpedertvetdkrplv
Timeline for d1n6db3: