Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) |
Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins) duplication: consists of 2 similar domains with 2 repeats in each Similar to the Methylmalonyl-CoA epimerase dimer |
Protein 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) [54603] (2 species) |
Species Pseudomonas sp. [TaxId:306] [54604] (10 PDB entries) |
Domain d1kwbb2: 1kwb B:133-288 [77558] mutant |
PDB Entry: 1kwb (more details), 2 Å
SCOPe Domain Sequences for d1kwbb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kwbb2 d.32.1.3 (B:133-288) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]} vsgfvtgdqgigafvrcvpdtakamafytevlgfvlsdiidiqmgpetsvpahflhcngr hhtialaafpipkrihhfmlqantiddvgyafdrldaagritsllgrhtndqtlsfyadt pspmievefgwgprtvdsswtvarhsrtamwghksv
Timeline for d1kwbb2: