Lineage for d1iyjb3 (1iyj B:2599-2731)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789342Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins)
    barrel, closed; n=5, S=10
  6. 2789377Protein OB-fold domains of BRCA2, N- and middle domain [418918] (2 species)
    protein duplication: tandem repeat of three OB-fold domains
  7. 2789383Species Norway rat (Rattus norvegicus) [TaxId:10116] [419346] (1 PDB entry)
  8. 2789384Domain d1iyjb3: 1iyj B:2599-2731 [76950]
    Other proteins in same PDB: d1iyjb1, d1iyjb2, d1iyjb5, d1iyjd1, d1iyjd2, d1iyjd5
    protein/DNA complex

Details for d1iyjb3

PDB Entry: 1iyj (more details), 3.4 Å

PDB Description: structure of a brca2-dss1 complex
PDB Compounds: (B:) breast cancer susceptibility

SCOPe Domain Sequences for d1iyjb3:

Sequence, based on SEQRES records: (download)

>d1iyjb3 b.40.4.3 (B:2599-2731) OB-fold domains of BRCA2, N- and middle domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rsalkkilerddtaaktlvlcvsdiislstnvsetsgskassedsnkvdtieltdgwyav
kaqldppllalvksgrltvgqkiitqgaelvgspdacapleapdslrlkisanstrparw
hsklgffhdprpf

Sequence, based on observed residues (ATOM records): (download)

>d1iyjb3 b.40.4.3 (B:2599-2731) OB-fold domains of BRCA2, N- and middle domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rsalkkilerddtaaktlvlcvsdiislskvdtieltdgwyavkaqldppllalvksgrl
tvgqkiitqgaelvgspdacapleapdslrlkisanstrparwhsklgffhdprpf

SCOPe Domain Coordinates for d1iyjb3:

Click to download the PDB-style file with coordinates for d1iyjb3.
(The format of our PDB-style files is described here.)

Timeline for d1iyjb3: