Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins) barrel, closed; n=5, S=10 |
Protein OB-fold domains of BRCA2, N- and middle domain [418918] (2 species) protein duplication: tandem repeat of three OB-fold domains |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [419346] (1 PDB entry) |
Domain d1iyjb3: 1iyj B:2599-2731 [76950] Other proteins in same PDB: d1iyjb1, d1iyjb2, d1iyjb5, d1iyjd1, d1iyjd2, d1iyjd5 protein/DNA complex |
PDB Entry: 1iyj (more details), 3.4 Å
SCOPe Domain Sequences for d1iyjb3:
Sequence, based on SEQRES records: (download)
>d1iyjb3 b.40.4.3 (B:2599-2731) OB-fold domains of BRCA2, N- and middle domain {Norway rat (Rattus norvegicus) [TaxId: 10116]} rsalkkilerddtaaktlvlcvsdiislstnvsetsgskassedsnkvdtieltdgwyav kaqldppllalvksgrltvgqkiitqgaelvgspdacapleapdslrlkisanstrparw hsklgffhdprpf
>d1iyjb3 b.40.4.3 (B:2599-2731) OB-fold domains of BRCA2, N- and middle domain {Norway rat (Rattus norvegicus) [TaxId: 10116]} rsalkkilerddtaaktlvlcvsdiislskvdtieltdgwyavkaqldppllalvksgrl tvgqkiitqgaelvgspdacapleapdslrlkisanstrparwhsklgffhdprpf
Timeline for d1iyjb3: