Class f: Membrane and cell surface proteins and peptides [56835] (34 folds) |
Fold f.35: Multidrug efflux transporter AcrB transmembrane domain [82865] (1 superfamily) 12 transmembrane helices; duplication: the N- and C-terminal halves of the whole proteins are structurally similar |
Superfamily f.35.1: Multidrug efflux transporter AcrB transmembrane domain [82866] (1 family) |
Family f.35.1.1: Multidrug efflux transporter AcrB transmembrane domain [82867] (1 protein) |
Protein Multidrug efflux transporter AcrB transmembrane domain [82868] (1 species) |
Species Escherichia coli [TaxId:562] [82869] (1 PDB entry) |
Domain d1iwga8: 1iwg A:513-566,A:869-1036 [76881] Other proteins in same PDB: d1iwga1, d1iwga2, d1iwga3, d1iwga4, d1iwga5, d1iwga6 |
PDB Entry: 1iwg (more details), 3.5 Å
SCOP Domain Sequences for d1iwga8:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iwga8 f.35.1.1 (A:513-566,A:869-1036) Multidrug efflux transporter AcrB transmembrane domain {Escherichia coli} fgwfnrmfeksthhytdsvggilrstgrylvlyliivvgmaylfvrlpssflpdXsgnqa pslyaislivvflclaalyeswsipfsvmlvvplgvigallaatfrgltndvyfqvgllt tiglsaknailivefakdlmdkegkglieatldavrmrlrpilmtslafilgvmplvist gagsgaqnavgtgvmggmvtatvlaiffvpvffvvvrrrfsrk
Timeline for d1iwga8: