SCOP 1.63: Domain d1iwga4: 1iwg A:674-724,A:813-859

Lineage for d1iwga4 (1iwg A:674-724,A:813-859)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.58: Ferredoxin-like [54861] (44 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.44: Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains [82693] (1 family)
   duplication: the N- and C-terminal halves of the whole proteins are structurally similar; each half contains two domains of this fold

5. Family d.58.44.1: Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains [82694] (1 protein)

6. Protein Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains [82695] (1 species)
   PN2 and PC2 subdomains are interupted by the inserted subdomains DN and DC, respectively

7. Species Escherichia coli [TaxId:562] [82696] (1 PDB entry)

8. Domain d1iwga4: 1iwg A:674-724,A:813-859 [76877]
   Other proteins in same PDB: d1iwga5, d1iwga6, d1iwga7, d1iwga8

Details for d1iwga4

PDB Entry: 1iwg, 3.5 Å

PDB Description: Crystal structure of Bacterial Multidrug Efflux transporter AcrB

SCOP Domain Sequences for d1iwga4:

Sequence, based on SEQRES records:

>d1iwga4 d.58.44.1 (A:674-724,A:813-859) Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains {Escherichia coli}
lgtatgfdfelidqaglghekltqarnqllaeaakhpdmltsvrpngledtXsprleryn
glpsmeilgqaapgkstgeamelmeqlasklptgvgydw

Sequence, based on observed residues (ATOM records):

>d1iwga4 d.58.44.1 (A:674-724,A:813-859) Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains {Escherichia coli}
lgtatgfdfelidqaglghekltqarnqllaeaakhpmltsvrpngledtXsprleryng
lpsmeilgqaapgkstgeamelmeqlasklptgvgydw

Timeline for d1iwga4:

• d1iwga4 is new in SCOP 1.63
  
• d1iwga4 appears in SCOP 1.65
  
• d1iwga4 appears in the current release, SCOPe 2.08