Class b: All beta proteins [48724] (180 folds) |
Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily) pseudobarrel; capped on both ends by alpha-helices |
Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (2 families) automatically mapped to Pfam PF01149 |
Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (4 proteins) |
Protein DNA repair protein MutM (Fpg) [81621] (4 species) |
Species Bacillus stearothermophilus [TaxId:1422] [81612] (23 PDB entries) |
Domain d1l1za2: 1l1z A:2-134 [75912] Other proteins in same PDB: d1l1za1, d1l1za3 covalent-DNA intermediate protein/DNA complex; complexed with zn |
PDB Entry: 1l1z (more details), 1.7 Å
SCOPe Domain Sequences for d1l1za2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l1za2 b.113.1.1 (A:2-134) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus [TaxId: 1422]} pelpevetirrtllplivgktiedvrifwpniirhprdseafaarmigqtvrglerrgkf lkflldrdalishlrmegryavasaleplephthvvfcftdgselryrdvrkfgtmhvya keeadrrpplael
Timeline for d1l1za2: