Lineage for d1l1za2 (1l1z A:2-134)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 235563Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily)
    pseudobarrel; capped on both ends by alpha-helices
  4. 235564Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (1 family) (S)
  5. 235565Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (2 proteins)
  6. 235566Protein DNA repair protein MutM (Fpg) [81621] (4 species)
  7. 235567Species Bacillus stearothermophilus [TaxId:1422] [81612] (5 PDB entries)
  8. 235568Domain d1l1za2: 1l1z A:2-134 [75912]
    Other proteins in same PDB: d1l1za1, d1l1za3
    covalent-DNA intermediate
    complexed with ped, zn

Details for d1l1za2

PDB Entry: 1l1z (more details), 1.7 Å

PDB Description: MutM (Fpg) Covalent-DNA Intermediate

SCOP Domain Sequences for d1l1za2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l1za2 b.113.1.1 (A:2-134) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus}
pelpevetirrtllplivgktiedvrifwpniirhprdseafaarmigqtvrglerrgkf
lkflldrdalishlrmegryavasaleplephthvvfcftdgselryrdvrkfgtmhvya
keeadrrpplael

SCOP Domain Coordinates for d1l1za2:

Click to download the PDB-style file with coordinates for d1l1za2.
(The format of our PDB-style files is described here.)

Timeline for d1l1za2: