Lineage for d1gaxb4 (1gax B:797-862)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1979820Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1980026Superfamily a.2.7: tRNA-binding arm [46589] (5 families) (S)
    formerly a class II aminoacyl-tRNA synthetase N-domain
  5. 1980043Family a.2.7.3: Valyl-tRNA synthetase (ValRS) C-terminal domain [81635] (1 protein)
    automatically mapped to Pfam PF10458
  6. 1980044Protein Valyl-tRNA synthetase (ValRS) C-terminal domain [81634] (1 species)
  7. 1980045Species Thermus thermophilus [TaxId:274] [81633] (3 PDB entries)
  8. 1980049Domain d1gaxb4: 1gax B:797-862 [75844]
    Other proteins in same PDB: d1gaxa2, d1gaxa3, d1gaxa5, d1gaxb2, d1gaxb3, d1gaxb5
    protein/RNA complex; complexed with vaa, zn

Details for d1gaxb4

PDB Entry: 1gax (more details), 2.9 Å

PDB Description: crystal structure of thermus thermophilus valyl-trna synthetase complexed with trna(val) and valyl-adenylate analogue
PDB Compounds: (B:) valyl-tRNA synthetase

SCOPe Domain Sequences for d1gaxb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gaxb4 a.2.7.3 (B:797-862) Valyl-tRNA synthetase (ValRS) C-terminal domain {Thermus thermophilus [TaxId: 274]}
dveewrrrqekrlkellalaersqrklaspgfrekapkevveaeearlkenleqaerire
alsqig

SCOPe Domain Coordinates for d1gaxb4:

Click to download the PDB-style file with coordinates for d1gaxb4.
(The format of our PDB-style files is described here.)

Timeline for d1gaxb4: