Lineage for d1gaxb3 (1gax B:1-189,B:343-578)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2118897Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2118898Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2118899Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 2119125Protein Valyl-tRNA synthetase (ValRS) [52390] (1 species)
  7. 2119126Species Thermus thermophilus [TaxId:274] [52391] (3 PDB entries)
  8. 2119130Domain d1gaxb3: 1gax B:1-189,B:343-578 [31596]
    Other proteins in same PDB: d1gaxa2, d1gaxa4, d1gaxa5, d1gaxb2, d1gaxb4, d1gaxb5
    protein/RNA complex; complexed with vaa, zn

Details for d1gaxb3

PDB Entry: 1gax (more details), 2.9 Å

PDB Description: crystal structure of thermus thermophilus valyl-trna synthetase complexed with trna(val) and valyl-adenylate analogue
PDB Compounds: (B:) valyl-tRNA synthetase

SCOPe Domain Sequences for d1gaxb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gaxb3 c.26.1.1 (B:1-189,B:343-578) Valyl-tRNA synthetase (ValRS) {Thermus thermophilus [TaxId: 274]}
mdlpkaydpksvepkwaekwaknpfvanpksgkppfvifmpppnvtgslhmghaldnslq
dalirykrmrgfeavwlpgtdhagiatqvvverlllkegktrhdlgrekflervwqwkee
sggtilkqlkrlgasadwsreaftmdekrsravryafsryyheglayraprlvnwcprce
ttlsdleveXtcsrcgtpieyaifpqwwlrmrplaeevlkglrrgdiafvperwkkvnmd
wlenvkdwnisrqlwwghqipawycedcqavnvprperyledptsceacgsprlkrdedv
fdtwfssalwplstlgwpeetedlkafypgdvlvtgydilflwvsrmevsgyhfmgerpf
ktvllhglvldekgqkmskskgnvidplemverygadalrfaliylatggqdirldlrwl
emarnf

SCOPe Domain Coordinates for d1gaxb3:

Click to download the PDB-style file with coordinates for d1gaxb3.
(The format of our PDB-style files is described here.)

Timeline for d1gaxb3: