Class a: All alpha proteins [46456] (286 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.7: tRNA-binding arm [46589] (5 families) formerly a class II aminoacyl-tRNA synthetase N-domain |
Family a.2.7.3: Valyl-tRNA synthetase (ValRS) C-terminal domain [81635] (1 protein) automatically mapped to Pfam PF10458 |
Protein Valyl-tRNA synthetase (ValRS) C-terminal domain [81634] (1 species) |
Species Thermus thermophilus [TaxId:274] [81633] (3 PDB entries) |
Domain d1gaxb4: 1gax B:797-862 [75844] Other proteins in same PDB: d1gaxa2, d1gaxa3, d1gaxa5, d1gaxb2, d1gaxb3, d1gaxb5 protein/RNA complex; complexed with vaa, zn |
PDB Entry: 1gax (more details), 2.9 Å
SCOPe Domain Sequences for d1gaxb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gaxb4 a.2.7.3 (B:797-862) Valyl-tRNA synthetase (ValRS) C-terminal domain {Thermus thermophilus [TaxId: 274]} dveewrrrqekrlkellalaersqrklaspgfrekapkevveaeearlkenleqaerire alsqig
Timeline for d1gaxb4:
View in 3D Domains from other chains: (mouse over for more information) d1gaxa2, d1gaxa3, d1gaxa4, d1gaxa5 |