Lineage for d1m1xa2 (1m1x A:599-737)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 223232Superfamily b.1.15: Integrin domains [69179] (1 family) (S)
  5. 223233Family b.1.15.1: Integrin domains [69180] (2 proteins)
  6. 223239Protein Thigh, calf-1 and calf-2 domains of integrin alpha [69181] (1 species)
  7. 223240Species Human (Homo sapiens) [TaxId:9606] [69182] (3 PDB entries)
  8. 223242Domain d1m1xa2: 1m1x A:599-737 [74423]
    Other proteins in same PDB: d1m1xa4, d1m1xb1, d1m1xb2, d1m1xb3, d1m1xb4, d1m1xb5

Details for d1m1xa2

PDB Entry: 1m1x (more details), 3.3 Å

PDB Description: crystal structure of the extracellular segment of integrin alpha vbeta3 bound to mn2+

SCOP Domain Sequences for d1m1xa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m1xa2 b.1.15.1 (A:599-737) Thigh, calf-1 and calf-2 domains of integrin alpha {Human (Homo sapiens)}
dnvckpklevsvdsdqkkiyigddnpltlivkaqnqgegayeaelivsiplqadfigvvr
nnealarlscafktenqtrqvvcdlgnpmkagtqllaglrfsvhqqsemdtsvkfdlqiq
ssnlfdkvspvvshkvdla

SCOP Domain Coordinates for d1m1xa2:

Click to download the PDB-style file with coordinates for d1m1xa2.
(The format of our PDB-style files is described here.)

Timeline for d1m1xa2: