Lineage for d1m1xb2 (1m1x B:107-354)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 247390Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 247391Superfamily c.62.1: vWA-like [53300] (2 families) (S)
  5. 247392Family c.62.1.1: Integrin A (or I) domain [53301] (8 proteins)
  6. 247408Protein Integrin beta A domain [69542] (1 species)
  7. 247409Species Human (Homo sapiens) [TaxId:9606] [69543] (3 PDB entries)
  8. 247410Domain d1m1xb2: 1m1x B:107-354 [74427]
    Other proteins in same PDB: d1m1xa1, d1m1xa2, d1m1xa3, d1m1xa4, d1m1xb1, d1m1xb3, d1m1xb4, d1m1xb5
    complexed with mn, nag

Details for d1m1xb2

PDB Entry: 1m1x (more details), 3.3 Å

PDB Description: crystal structure of the extracellular segment of integrin alpha vbeta3 bound to mn2+

SCOP Domain Sequences for d1m1xb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m1xb2 c.62.1.1 (B:107-354) Integrin beta A domain {Human (Homo sapiens)}
vedypvdiyylmdlsysmkddlwsiqnlgtklatqmrkltsnlrigfgafvdkpvspymy
isppealenpcydmkttclpmfgykhvltltdqvtrfneevkkqsvsrnrdapeggfdai
mqatvcdekigwrndashllvfttdakthialdgrlagivqpndgqchvgsdnhysastt
mdypslglmteklsqkninlifavtenvvnlyqnyselipgttvgvlsmdssnvlqlivd
aygkirsk

SCOP Domain Coordinates for d1m1xb2:

Click to download the PDB-style file with coordinates for d1m1xb2.
(The format of our PDB-style files is described here.)

Timeline for d1m1xb2: