Lineage for d1m1xa2 (1m1x A:599-737)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 291450Superfamily b.1.15: Integrin domains [69179] (1 family) (S)
  5. 291451Family b.1.15.1: Integrin domains [69180] (2 proteins)
  6. 291457Protein Thigh, calf-1 and calf-2 domains of integrin alpha [69181] (1 species)
  7. 291458Species Human (Homo sapiens) [TaxId:9606] [69182] (3 PDB entries)
  8. 291460Domain d1m1xa2: 1m1x A:599-737 [74423]
    Other proteins in same PDB: d1m1xa4, d1m1xb1, d1m1xb2, d1m1xb3, d1m1xb4, d1m1xb5

Details for d1m1xa2

PDB Entry: 1m1x (more details), 3.3 Å

PDB Description: crystal structure of the extracellular segment of integrin alpha vbeta3 bound to mn2+

SCOP Domain Sequences for d1m1xa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m1xa2 b.1.15.1 (A:599-737) Thigh, calf-1 and calf-2 domains of integrin alpha {Human (Homo sapiens)}
dnvckpklevsvdsdqkkiyigddnpltlivkaqnqgegayeaelivsiplqadfigvvr
nnealarlscafktenqtrqvvcdlgnpmkagtqllaglrfsvhqqsemdtsvkfdlqiq
ssnlfdkvspvvshkvdla

SCOP Domain Coordinates for d1m1xa2:

Click to download the PDB-style file with coordinates for d1m1xa2.
(The format of our PDB-style files is described here.)

Timeline for d1m1xa2: