Lineage for d1m1jb2 (1m1j B:63-199)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3039948Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families) (S)
  5. 3039949Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
    in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails
  6. 3040014Protein Fibrinogen beta chain [88892] (4 species)
  7. 3040015Species Chicken (Gallus gallus) [TaxId:9031] [88894] (1 PDB entry)
  8. 3040016Domain d1m1jb2: 1m1j B:63-199 [74371]
    Other proteins in same PDB: d1m1ja_, d1m1jb1, d1m1jc1, d1m1jc2, d1m1jd_, d1m1je1, d1m1jf1, d1m1jf2
    complexed with ca, nag, ndg

Details for d1m1jb2

PDB Entry: 1m1j (more details), 2.7 Å

PDB Description: crystal structure of native chicken fibrinogen with two different bound ligands
PDB Compounds: (B:) fibrinogen beta chain

SCOPe Domain Sequences for d1m1jb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m1jb2 h.1.8.1 (B:63-199) Fibrinogen beta chain {Chicken (Gallus gallus) [TaxId: 9031]}
iypdaggckhpldelgvlcptgcelqttllkqektvkpvlrdlkdrvakfsdtsttmyqy
vnmidnklvktqkqrkdndiilseyntemelhynyikdnldnnipsslrvlravidslhk
kiqklenaiatqtdycr

SCOPe Domain Coordinates for d1m1jb2:

Click to download the PDB-style file with coordinates for d1m1jb2.
(The format of our PDB-style files is described here.)

Timeline for d1m1jb2: