Lineage for d1m1je1 (1m1j E:200-463)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2560074Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
    unusual fold
  4. 2560075Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (2 families) (S)
  5. 2560076Family d.171.1.1: Fibrinogen C-terminal domain-like [56497] (2 proteins)
    automatically mapped to Pfam PF00147
  6. 2560077Protein Fibrinogen C-terminal domains [56498] (7 species)
  7. 2560078Species Chicken (Gallus gallus), beta [TaxId:9031] [69860] (1 PDB entry)
  8. 2560080Domain d1m1je1: 1m1j E:200-463 [74375]
    Other proteins in same PDB: d1m1ja_, d1m1jb2, d1m1jc2, d1m1jd_, d1m1je2, d1m1jf2
    complexed with ca, nag, ndg

Details for d1m1je1

PDB Entry: 1m1j (more details), 2.7 Å

PDB Description: Crystal structure of native chicken fibrinogen with two different bound ligands
PDB Compounds: (E:) fibrinogen beta chain

SCOPe Domain Sequences for d1m1je1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m1je1 d.171.1.1 (E:200-463) Fibrinogen C-terminal domains {Chicken (Gallus gallus), beta [TaxId: 9031]}
spcvascnipvvsgrecediyrkggetsemyiiqpdpfttpyrvycdmetdnggwtliqn
rqdgsvnfgrawdeykrgfgniaksggkkycdtpgeywlgndkisqltkigptkvlieme
dwngdkvsalyggftihnegnkyqlsvsnykgnagnalmegasqlygenrtmtihngmyf
stydrdndgwlttdprkqcskedgggwwynrchaanpngryywggtyswdmakhgtddgi
vwmnwkgswysmkkmsmkikpyfp

SCOPe Domain Coordinates for d1m1je1:

Click to download the PDB-style file with coordinates for d1m1je1.
(The format of our PDB-style files is described here.)

Timeline for d1m1je1: