PDB entry 1m1j

View 1m1j on RCSB PDB site
Description: Crystal structure of native chicken fibrinogen with two different bound ligands
Class: blood clotting
Keywords: coiled coils, disulfide rings, fibrinogen, blood clotting
Deposited on 2002-06-19, released 2002-06-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.227
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fibrinogen alpha subunit
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14448
      • see remark 999 (48)
    Domains in SCOPe 2.07: d1m1ja_
  • Chain 'B':
    Compound: fibrinogen beta chain
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m1jb1, d1m1jb2
  • Chain 'C':
    Compound: Fibrinogen gamma chain
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O93568
      • see remark 999 (285)
    Domains in SCOPe 2.07: d1m1jc1, d1m1jc2
  • Chain 'D':
    Compound: Fibrinogen alpha subunit
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14448
      • see remark 999 (48)
    Domains in SCOPe 2.07: d1m1jd_
  • Chain 'E':
    Compound: fibrinogen beta chain
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m1je1, d1m1je2
  • Chain 'F':
    Compound: Fibrinogen gamma chain
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O93568
      • see remark 999 (285)
    Domains in SCOPe 2.07: d1m1jf1, d1m1jf2
  • Chain 'G':
    Compound: GLY-PRO-ARG-PRO peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1M1J (0-3)
  • Chain 'H':
    Compound: GLY-PRO-ARG-PRO peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1M1J (0-3)
  • Chain 'I':
    Compound: GLY-HIS-ARG-PRO peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1M1J (0-3)
  • Chain 'J':
    Compound: GLY-HIS-ARG-PRO peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1M1J (0-3)
  • Heterogens: NDG, NAG, CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m1jA (A:)
    qdgkttfekeggggrgprilenmhessckyeknwpicvdddwgtkcpsgcrmqgiiddtd
    qnysqridnirqqladsqnkyktsnrvivetinilkpglegaqqldenyghvstelrrri
    vtlkqrvatqvnrikalqnsiqeqvvemkrlevdidikirackgscarsfdyqvdkegyd
    niqkhltqassidmhpdfqtttlstlkmrplkdsnvpehfklkpspemqamsafnnikqm
    qvvlerpetdhvaeargdsspshtgklitsshrrespslvdktssassvhrctrtvtkkv
    isgpdgpreeivekmvssdgsdcshlqggregstyhfsgtgdfhkldrllpdlesffthd
    svstssrhsigsstsshvtgagsshlgtggkdkftdlgeeeeddfgglqpsgfaagsash
    sktvltsssssfnkggstfetkslktretseqlggvqhdqsaedtpdfkarsfrpaamst
    rrsyngkgtqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m1jA (A:)
    sckyeknwpicvdddwgtkcpsgcrmqgiiddtdqnysqridnirqqladsqnkyktsnr
    vivetinilkpglegaqqldenyghvstelrrrivtlkqrvatqvnrikalqnsiqeqvv
    emkrlevdidikirackgscarsfdyqvdkegydniqkhltqassidmhpdfqtttlstl
    kmrplkdsnvpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1m1jB (B:)
    qasveydneedspqidarahrpldkrqeaaptlrpvappisgtgyqprppkqdkqamkkg
    piiypdaggckhpldelgvlcptgcelqttllkqektvkpvlrdlkdrvakfsdtsttmy
    qyvnmidnklvktqkqrkdndiilseyntemelhynyikdnldnnipsslrvlravidsl
    hkkiqklenaiatqtdycrspcvascnipvvsgrecediyrkggetsemyiiqpdpfttp
    yrvycdmetdnggwtliqnrqdgsvnfgrawdeykrgfgniaksggkkycdtpgeywlgn
    dkisqltkigptkvliemedwngdkvsalyggftihnegnkyqlsvsnykgnagnalmeg
    asqlygenrtmtihngmyfstydrdndgwlttdprkqcskedgggwwynrchaanpngry
    ywggtyswdmakhgtddgivwmnwkgswysmkkmsmkikpyfpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m1jB (B:)
    iypdaggckhpldelgvlcptgcelqttllkqektvkpvlrdlkdrvakfsdtsttmyqy
    vnmidnklvktqkqrkdndiilseyntemelhynyikdnldnnipsslrvlravidslhk
    kiqklenaiatqtdycrspcvascnipvvsgrecediyrkggetsemyiiqpdpfttpyr
    vycdmetdnggwtliqnrqdgsvnfgrawdeykrgfgniaksggkkycdtpgeywlgndk
    isqltkigptkvliemedwngdkvsalyggftihnegnkyqlsvsnykgnagnalmegas
    qlygenrtmtihngmyfstydrdndgwlttdprkqcskedgggwwynrchaanpngryyw
    ggtyswdmakhgtddgivwmnwkgswysmkkmsmkikpyfpd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1m1jC (C:)
    yiatrenccilderfgsycpttcgiadffnkyrlttdgelleiegllqqatnstgsieyl
    iqhiktiypsekqtlpqsieqltqkskkiieeiiryentilahentiqqltdmhimnsnk
    itqlkqkiaqleshcqepckdtaeiqettgrdcqdiankgarksglyfikpqkakqsflv
    yceidtygngwtvlqrrldgsedfrrnwvqykegfghlspddttefwlgnekihlittqs
    tlpyalrieledwsgkkgtadyavfkvgteedkyrltyayfiggeagdafdgfnfgddps
    dksytyhngmrfstfdndndnfegncaeqdgsgwwmnrchaghlngpyyiggvysrdtgt
    nsydngiiwatwrdrwysmkkttmkiipfnrlsidgqqhsgglkqvgds
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m1jC (C:)
    trenccilderfgsycpttcgiadffnkyrlttdgelleiegllqqatnstgsieyliqh
    iktiypsekqtlpqsieqltqkskkiieeiiryentilahentiqqltdmhimnsnkitq
    lkqkiaqleshcqepckdtaeiqettgrdcqdiankgarksglyfikpqkakqsflvyce
    idtygngwtvlqrrldgsedfrrnwvqykegfghlspddttefwlgnekihlittqstlp
    yalrieledwsgkkgtadyavfkvgteedkyrltyayfiggeagdafdgfnfgddpsdks
    ytyhngmrfstfdndndnfegncaeqdgsgwwmnrchaghlngpyyiggvysrdtgtnsy
    dngiiwatwrdrwysmkkttmkiipfnrls
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1m1jD (D:)
    qdgkttfekeggggrgprilenmhessckyeknwpicvdddwgtkcpsgcrmqgiiddtd
    qnysqridnirqqladsqnkyktsnrvivetinilkpglegaqqldenyghvstelrrri
    vtlkqrvatqvnrikalqnsiqeqvvemkrlevdidikirackgscarsfdyqvdkegyd
    niqkhltqassidmhpdfqtttlstlkmrplkdsnvpehfklkpspemqamsafnnikqm
    qvvlerpetdhvaeargdsspshtgklitsshrrespslvdktssassvhrctrtvtkkv
    isgpdgpreeivekmvssdgsdcshlqggregstyhfsgtgdfhkldrllpdlesffthd
    svstssrhsigsstsshvtgagsshlgtggkdkftdlgeeeeddfgglqpsgfaagsash
    sktvltsssssfnkggstfetkslktretseqlggvqhdqsaedtpdfkarsfrpaamst
    rrsyngkgtqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m1jD (D:)
    sckyeknwpicvdddwgtkcpsgcrmqgiiddtdqnysqridnirqqladsqnkyktsnr
    vivetinilkpglegaqqldenyghvstelrrrivtlkqrvatqvnrikalqnsiqeqvv
    emkrlevdidikirackgscarsfdyqvdkegydniqkhltqassidmhpdfqtttlstl
    kmrplkdsnvpehf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1m1jE (E:)
    qasveydneedspqidarahrpldkrqeaaptlrpvappisgtgyqprppkqdkqamkkg
    piiypdaggckhpldelgvlcptgcelqttllkqektvkpvlrdlkdrvakfsdtsttmy
    qyvnmidnklvktqkqrkdndiilseyntemelhynyikdnldnnipsslrvlravidsl
    hkkiqklenaiatqtdycrspcvascnipvvsgrecediyrkggetsemyiiqpdpfttp
    yrvycdmetdnggwtliqnrqdgsvnfgrawdeykrgfgniaksggkkycdtpgeywlgn
    dkisqltkigptkvliemedwngdkvsalyggftihnegnkyqlsvsnykgnagnalmeg
    asqlygenrtmtihngmyfstydrdndgwlttdprkqcskedgggwwynrchaanpngry
    ywggtyswdmakhgtddgivwmnwkgswysmkkmsmkikpyfpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m1jE (E:)
    iypdaggckhpldelgvlcptgcelqttllkqektvkpvlrdlkdrvakfsdtsttmyqy
    vnmidnklvktqkqrkdndiilseyntemelhynyikdnldnnipsslrvlravidslhk
    kiqklenaiatqtdycrspcvascnipvvsgrecediyrkggetsemyiiqpdpfttpyr
    vycdmetdnggwtliqnrqdgsvnfgrawdeykrgfgniaksggkkycdtpgeywlgndk
    isqltkigptkvliemedwngdkvsalyggftihnegnkyqlsvsnykgnagnalmegas
    qlygenrtmtihngmyfstydrdndgwlttdprkqcskedgggwwynrchaanpngryyw
    ggtyswdmakhgtddgivwmnwkgswysmkkmsmkikpyfp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1m1jF (F:)
    yiatrenccilderfgsycpttcgiadffnkyrlttdgelleiegllqqatnstgsieyl
    iqhiktiypsekqtlpqsieqltqkskkiieeiiryentilahentiqqltdmhimnsnk
    itqlkqkiaqleshcqepckdtaeiqettgrdcqdiankgarksglyfikpqkakqsflv
    yceidtygngwtvlqrrldgsedfrrnwvqykegfghlspddttefwlgnekihlittqs
    tlpyalrieledwsgkkgtadyavfkvgteedkyrltyayfiggeagdafdgfnfgddps
    dksytyhngmrfstfdndndnfegncaeqdgsgwwmnrchaghlngpyyiggvysrdtgt
    nsydngiiwatwrdrwysmkkttmkiipfnrlsidgqqhsgglkqvgds
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m1jF (F:)
    renccilderfgsycpttcgiadffnkyrlttdgelleiegllqqatnstgsieyliqhi
    ktiypsekqtlpqsieqltqkskkiieeiiryentilahentiqqltdmhimnsnkitql
    kqkiaqleshcqepckdtaeiqettgrdcqdiankgarksglyfikpqkakqsflvycei
    dtygngwtvlqrrldgsedfrrnwvqykegfghlspddttefwlgnekihlittqstlpy
    alrieledwsgkkgtadyavfkvgteedkyrltyayfiggeagdafdgfnfgddpsdksy
    tyhngmrfstfdndndnfegncaeqdgsgwwmnrchaghlngpyyiggvysrdtgtnsyd
    ngiiwatwrdrwysmkkttmkiipfnrls
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.