Lineage for d1l5ga2 (1l5g A:599-737)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 367700Superfamily b.1.15: Integrin domains [69179] (1 family) (S)
  5. 367701Family b.1.15.1: Integrin domains [69180] (2 proteins)
  6. 367707Protein Thigh, calf-1 and calf-2 domains of integrin alpha [69181] (1 species)
  7. 367708Species Human (Homo sapiens) [TaxId:9606] [69182] (3 PDB entries)
  8. 367716Domain d1l5ga2: 1l5g A:599-737 [73582]
    Other proteins in same PDB: d1l5ga4, d1l5gb1, d1l5gb2, d1l5gb3, d1l5gb4, d1l5gb5

Details for d1l5ga2

PDB Entry: 1l5g (more details), 3.2 Å

PDB Description: crystal structure of the extracellular segment of integrin avb3 in complex with an arg-gly-asp ligand

SCOP Domain Sequences for d1l5ga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l5ga2 b.1.15.1 (A:599-737) Thigh, calf-1 and calf-2 domains of integrin alpha {Human (Homo sapiens)}
dnvckpklevsvdsdqkkiyigddnpltlivkaqnqgegayeaelivsiplqadfigvvr
nnealarlscafktenqtrqvvcdlgnpmkagtqllaglrfsvhqqsemdtsvkfdlqiq
ssnlfdkvspvvshkvdla

SCOP Domain Coordinates for d1l5ga2:

Click to download the PDB-style file with coordinates for d1l5ga2.
(The format of our PDB-style files is described here.)

Timeline for d1l5ga2: