![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.15: Integrin domains [69179] (1 family) ![]() |
![]() | Family b.1.15.1: Integrin domains [69180] (2 proteins) |
![]() | Protein Thigh, calf-1 and calf-2 domains of integrin alpha [69181] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [69182] (3 PDB entries) |
![]() | Domain d1l5ga2: 1l5g A:599-737 [73582] Other proteins in same PDB: d1l5ga4, d1l5gb1, d1l5gb2, d1l5gb3, d1l5gb4, d1l5gb5 |
PDB Entry: 1l5g (more details), 3.2 Å
SCOP Domain Sequences for d1l5ga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l5ga2 b.1.15.1 (A:599-737) Thigh, calf-1 and calf-2 domains of integrin alpha {Human (Homo sapiens)} dnvckpklevsvdsdqkkiyigddnpltlivkaqnqgegayeaelivsiplqadfigvvr nnealarlscafktenqtrqvvcdlgnpmkagtqllaglrfsvhqqsemdtsvkfdlqiq ssnlfdkvspvvshkvdla
Timeline for d1l5ga2: