Lineage for d1l5gb1 (1l5g B:55-106,B:355-434)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 367700Superfamily b.1.15: Integrin domains [69179] (1 family) (S)
  5. 367701Family b.1.15.1: Integrin domains [69180] (2 proteins)
  6. 367702Protein Hybrid domain of integrin beta [69183] (1 species)
  7. 367703Species Human (Homo sapiens) [TaxId:9606] [69184] (3 PDB entries)
  8. 367706Domain d1l5gb1: 1l5g B:55-106,B:355-434 [73585]
    Other proteins in same PDB: d1l5ga1, d1l5ga2, d1l5ga3, d1l5ga4, d1l5gb2, d1l5gb3, d1l5gb4, d1l5gb5
    complexed with mn, mva, nag

Details for d1l5gb1

PDB Entry: 1l5g (more details), 3.2 Å

PDB Description: crystal structure of the extracellular segment of integrin avb3 in complex with an arg-gly-asp ligand

SCOP Domain Sequences for d1l5gb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l5gb1 b.1.15.1 (B:55-106,B:355-434) Hybrid domain of integrin beta {Human (Homo sapiens)}
efpvsearvledrplsdkgsgdssqvtqvspqrialrlrpddsknfsiqvrqXvelevrd
lpeelslsfnatclnnevipglkscmglkigdtvsfsieakvrgcpqekeksftikpvgf
kdslivqvtfdcd

SCOP Domain Coordinates for d1l5gb1:

Click to download the PDB-style file with coordinates for d1l5gb1.
(The format of our PDB-style files is described here.)

Timeline for d1l5gb1: