Lineage for d1klga2 (1klg A:4-81)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 190293Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 190294Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 190295Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)
  6. 190467Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (12 species)
  7. 190474Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [54460] (9 PDB entries)
  8. 190477Domain d1klga2: 1klg A:4-81 [72715]
    Other proteins in same PDB: d1klga1, d1klgb1, d1klgd1, d1klgd2

Details for d1klga2

PDB Entry: 1klg (more details), 2.4 Å

PDB Description: crystal structure of hla-dr1/tpi(23-37, thr28-->ile mutant) complexed with staphylococcal enterotoxin c3 variant 3b2 (sec3-3b2)

SCOP Domain Sequences for d1klga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1klga2 d.19.1.1 (A:4-81) MHC class II, N-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1}
ehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalani
avdkanleimtkrsnytp

SCOP Domain Coordinates for d1klga2:

Click to download the PDB-style file with coordinates for d1klga2.
(The format of our PDB-style files is described here.)

Timeline for d1klga2: