SCOP 1.61: Domain d1klgd2: 1klg D:122-239

Lineage for d1klgd2 (1klg D:122-239)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (12 proteins)

6. Protein Staphylococcal enterotoxin B, SEB [54342] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [54343] (13 PDB entries)

8. Domain d1klgd2: 1klg D:122-239 [72719]
   Other proteins in same PDB: d1klga1, d1klga2, d1klgb1, d1klgb2, d1klgd1

Details for d1klgd2

PDB Entry: 1klg, 2.4 Å

PDB Description: crystal structure of hla-dr1/tpi(23-37, thr28-->ile mutant) complexed with staphylococcal enterotoxin c3 variant 3b2 (sec3-3b2)

SCOP Domain Sequences for d1klgd2:

Sequence; same for both SEQRES and ATOM records:

>d1klgd2 d.15.6.1 (D:122-239) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus}
hfdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspy
etgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng

Timeline for d1klgd2:

• d1klgd2 is new in SCOP 1.61
  
• d1klgd2 appears in SCOP 1.63
  
• d1klgd2 appears in the current release, SCOPe 2.08