![]() | Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies) |
![]() | Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) ![]() |
![]() | Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (12 proteins) |
![]() | Protein Staphylococcal enterotoxin B, SEB [54342] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [54343] (13 PDB entries) |
![]() | Domain d1klgd2: 1klg D:122-239 [72719] Other proteins in same PDB: d1klga1, d1klga2, d1klgb1, d1klgb2, d1klgd1 |
PDB Entry: 1klg (more details), 2.4 Å
SCOP Domain Sequences for d1klgd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1klgd2 d.15.6.1 (D:122-239) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus} hfdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspy etgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng
Timeline for d1klgd2:
![]() Domains from other chains: (mouse over for more information) d1klga1, d1klga2, d1klgb1, d1klgb2 |