Lineage for d1jlwb1 (1jlw B:91-217)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1089232Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1089233Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1089234Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)
  6. 1089376Protein Class delta GST [81355] (5 species)
    formerly a part of class theta enzymes
  7. 1089387Species Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId:123217] [74725] (1 PDB entry)
  8. 1089389Domain d1jlwb1: 1jlw B:91-217 [71743]
    Other proteins in same PDB: d1jlwa2, d1jlwb2

Details for d1jlwb1

PDB Entry: 1jlw (more details), 2.45 Å

PDB Description: Anopheles dirus species B glutathione S-transferases 1-4
PDB Compounds: (B:) glutathione transferase GST1-4

SCOPe Domain Sequences for d1jlwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jlwb1 a.45.1.1 (B:91-217) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId: 123217]}
sdprrravvhqrlffdvavlyqrfaeyyypqifgqkvpvgdpgrlrsmeqaleflntfle
geqyvaggddptiadlsilatiatyevagydlrryenvqrwyertsaivpgadknvegak
vfgryft

SCOPe Domain Coordinates for d1jlwb1:

Click to download the PDB-style file with coordinates for d1jlwb1.
(The format of our PDB-style files is described here.)

Timeline for d1jlwb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jlwb2