Class a: All alpha proteins [46456] (284 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
Protein Class delta GST [81355] (6 species) formerly a part of class theta enzymes |
Species Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId:123217] [74725] (1 PDB entry) |
Domain d1jlwb1: 1jlw B:91-217 [71743] Other proteins in same PDB: d1jlwa2, d1jlwb2 |
PDB Entry: 1jlw (more details), 2.45 Å
SCOPe Domain Sequences for d1jlwb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jlwb1 a.45.1.1 (B:91-217) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId: 123217]} sdprrravvhqrlffdvavlyqrfaeyyypqifgqkvpvgdpgrlrsmeqaleflntfle geqyvaggddptiadlsilatiatyevagydlrryenvqrwyertsaivpgadknvegak vfgryft
Timeline for d1jlwb1: