Lineage for d1jlwb1 (1jlw B:91-217)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 153066Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 153067Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 153068Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (4 proteins)
  6. 153080Protein Glutathione S-transferase [47618] (27 species)
  7. 153245Species Insect (Anopheles dirus b), isozyme 1-4 [74725] (1 PDB entry)
  8. 153247Domain d1jlwb1: 1jlw B:91-217 [71743]
    Other proteins in same PDB: d1jlwa2, d1jlwb2

Details for d1jlwb1

PDB Entry: 1jlw (more details), 2.45 Å

PDB Description: Anopheles dirus species B glutathione S-transferases 1-4

SCOP Domain Sequences for d1jlwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jlwb1 a.45.1.1 (B:91-217) Glutathione S-transferase {Insect (Anopheles dirus b), isozyme 1-4}
sdprrravvhqrlffdvavlyqrfaeyyypqifgqkvpvgdpgrlrsmeqaleflntfle
geqyvaggddptiadlsilatiatyevagydlrryenvqrwyertsaivpgadknvegak
vfgryft

SCOP Domain Coordinates for d1jlwb1:

Click to download the PDB-style file with coordinates for d1jlwb1.
(The format of our PDB-style files is described here.)

Timeline for d1jlwb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jlwb2