SCOPe 2.08: Domain d1gzzb_: 1gzz B:

Lineage for d1gzzb_ (1gzz B:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.1: Insulin-like [56993] (1 superfamily)
   nearly all-alpha
   can be classified as disulfide-rich

4. Superfamily g.1.1: Insulin-like [56994] (1 family)

5. Family g.1.1.1: Insulin-like [56995] (5 proteins)

6. Protein Insulin-like growth factor [57002] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57003] (23 PDB entries)
   Uniprot P05019 49-110

8. Domain d1gzzb_: 1gzz B: [70830]
   complexed with c15

Details for d1gzzb_

PDB Entry: 1gzz, 2.3 Å

PDB Description: human insulin-like growth factor; hamburg data

PDB Compounds: (B:) insulin-like growth factor I

SCOPe Domain Sequences for d1gzzb_:

Sequence, based on SEQRES records:

>d1gzzb_ g.1.1.1 (B:) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]}
gpetlcgaelvdalqfvcgdrgfyfnkptgygsssrrapqtgivdeccfrscdlrrlemy
caplkp

Sequence, based on observed residues (ATOM records):

>d1gzzb_ g.1.1.1 (B:) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]}
gpetlcgaelvdalqfvcgdrgfyfnkptgyapqtgivdeccfrscdlrrlemycaplkp

Timeline for d1gzzb_:

• d1gzzb_ first appeared in SCOP 1.61
  
• d1gzzb_ appears in SCOPe 2.07