PDB entry 1gzz

View 1gzz on RCSB PDB site
Description: Human Insulin-like growth factor; Hamburg data
Class: growth factor
Keywords: growth factor, insulin family, igf-1, plasma
Deposited on 2002-06-10, released 2002-07-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: insulin-like growth factor I
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1gzzb_
  • Heterogens: C15, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gzzB (B:)
    gpetlcgaelvdalqfvcgdrgfyfnkptgygsssrrapqtgivdeccfrscdlrrlemy
    caplkpaksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gzzB (B:)
    gpetlcgaelvdalqfvcgdrgfyfnkptgyapqtgivdeccfrscdlrrlemycaplkp