Lineage for d1gzzb_ (1gzz B:)

  1. Root: SCOP 1.61
  2. 202290Class g: Small proteins [56992] (59 folds)
  3. 202291Fold g.1: Insulin-like [56993] (1 superfamily)
  4. 202292Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 202293Family g.1.1.1: Insulin-like [56995] (4 proteins)
  6. 202489Protein Insulin-like growth factor [57002] (1 species)
  7. 202490Species Human (Homo sapiens) [TaxId:9606] [57003] (12 PDB entries)
  8. 202495Domain d1gzzb_: 1gzz B: [70830]

Details for d1gzzb_

PDB Entry: 1gzz (more details), 2.3 Å

PDB Description: human insulin-like growth factor; hamburg data

SCOP Domain Sequences for d1gzzb_:

Sequence, based on SEQRES records: (download)

>d1gzzb_ g.1.1.1 (B:) Insulin-like growth factor {Human (Homo sapiens)}
gpetlcgaelvdalqfvcgdrgfyfnkptgygsssrrapqtgivdeccfrscdlrrlemy
caplkp

Sequence, based on observed residues (ATOM records): (download)

>d1gzzb_ g.1.1.1 (B:) Insulin-like growth factor {Human (Homo sapiens)}
gpetlcgaelvdalqfvcgdrgfyfnkptgyapqtgivdeccfrscdlrrlemycaplkp

SCOP Domain Coordinates for d1gzzb_:

Click to download the PDB-style file with coordinates for d1gzzb_.
(The format of our PDB-style files is described here.)

Timeline for d1gzzb_: