SCOPe 2.08: Domain d1gy9a_: 1gy9 A:

Lineage for d1gy9a_ (1gy9 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.5: TauD/TfdA-like [75038] (5 proteins)
   automatically mapped to Pfam PF02668

6. Protein Taurine/alpha-ketoglutarate dioxygenase TauD [75039] (2 species)

7. Species Escherichia coli [TaxId:562] [75040] (4 PDB entries)

8. Domain d1gy9a_: 1gy9 A: [70742]
   complexed with akg, fe, tau

Details for d1gy9a_

PDB Entry: 1gy9, 2.5 Å

PDB Description: taurine/alpha-ketoglutarate dioxygenase from escherichia coli

PDB Compounds: (A:) Alpha-Ketoglutarate-Dependent Taurine Dioxygenase

SCOPe Domain Sequences for d1gy9a_:

Sequence; same for both SEQRES and ATOM records:

>d1gy9a_ b.82.2.5 (A:) Taurine/alpha-ketoglutarate dioxygenase TauD {Escherichia coli [TaxId: 562]}
rlsitplgpyigaqisgadltrplsdnqfeqlyhavlrhqvvflrdqaitpqqqralaqr
fgelhihpvyphaegvdeiivldthndnppdndnwhtdvtfietppagailaakelpstg
gdtlwtsgiaayealsvpfrqllsglraehdfrksfpeykyrkteeehqrwreavaknpp
llhpvvrthpvsgkqalfvnegfttrivdvsekeseallsflfahitkpefqvrwrwqpn
diaiwdnrvtqhyanadylpqrrimhratilgdkpfyra

Timeline for d1gy9a_:

• d1gy9a_ first appeared in SCOP 1.61
  
• d1gy9a_ appears in SCOPe 2.07