Lineage for d1k83i2 (1k83 I:50-122)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 430156Fold g.41: Rubredoxin-like [57769] (13 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 430209Superfamily g.41.3: Zinc beta-ribbon [57783] (3 families) (S)
  5. 430210Family g.41.3.1: Transcriptional factor domain [57784] (3 proteins)
  6. 430211Protein RBP9 subunit of RNA polymerase II [57787] (2 species)
    contains two differently decorated domains of this fold
  7. 430214Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (4 PDB entries)
  8. 430218Domain d1k83i2: 1k83 I:50-122 [68284]
    Other proteins in same PDB: d1k83a_, d1k83b_, d1k83c1, d1k83c2, d1k83e1, d1k83e2, d1k83f_, d1k83h_, d1k83j_, d1k83k_, d1k83l_
    complexed with ilx, mn, trx, zn

Details for d1k83i2

PDB Entry: 1k83 (more details), 2.8 Å

PDB Description: Crystal Structure of Yeast RNA Polymerase II Complexed with the Inhibitor Alpha Amanitin

SCOP Domain Sequences for d1k83i2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k83i2 g.41.3.1 (I:50-122) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae)}
tnigetagvvqdigsdptlprsdrecpkchsrenvffqsqqrrkdtsmvlffvclscshi
ftsdqknkrtqfs

SCOP Domain Coordinates for d1k83i2:

Click to download the PDB-style file with coordinates for d1k83i2.
(The format of our PDB-style files is described here.)

Timeline for d1k83i2: