SCOP 1.67: Domain d1k83j_: 1k83 J:

Lineage for d1k83j_ (1k83 J:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family)

5. Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (1 protein)
   Zn-binding site is near the N-terminus

6. Protein RNA polymerase subunit RPB10 [46926] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63490] (4 PDB entries)

8. Domain d1k83j_: 1k83 J: [68285]
   Other proteins in same PDB: d1k83a_, d1k83b_, d1k83c1, d1k83c2, d1k83e1, d1k83e2, d1k83f_, d1k83h_, d1k83i1, d1k83i2, d1k83k_, d1k83l_
   complexed with ilx, mn, trx, zn

Details for d1k83j_

PDB Entry: 1k83, 2.8 Å

PDB Description: Crystal Structure of Yeast RNA Polymerase II Complexed with the Inhibitor Alpha Amanitin

SCOP Domain Sequences for d1k83j_:

Sequence; same for both SEQRES and ATOM records:

>d1k83j_ a.4.11.1 (J:) RNA polymerase subunit RPB10 {Baker's yeast (Saccharomyces cerevisiae)}
mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
lrynp

Timeline for d1k83j_:

• d1k83j_ first appeared in SCOP 1.59
  
• d1k83j_ appears in SCOP 1.65
  
• d1k83j_ appears in SCOP 1.69
  
• d1k83j_ appears in the current release, SCOPe 2.08