SCOP 1.67: Domain d1k83c2: 1k83 C:42-172

Lineage for d1k83c2 (1k83 C:42-172)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
   unusual fold; contains a left-handed beta-alpha-beta unit

4. Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family)

5. Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins)

6. Protein RPB3 [64462] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64463] (4 PDB entries)

8. Domain d1k83c2: 1k83 C:42-172 [68278]
   Other proteins in same PDB: d1k83a_, d1k83b_, d1k83c1, d1k83e1, d1k83e2, d1k83f_, d1k83h_, d1k83i1, d1k83i2, d1k83j_, d1k83k_, d1k83l_
   complexed with ilx, mn, trx, zn

Details for d1k83c2

PDB Entry: 1k83, 2.8 Å

PDB Description: Crystal Structure of Yeast RNA Polymerase II Complexed with the Inhibitor Alpha Amanitin

SCOP Domain Sequences for d1k83c2:

Sequence; same for both SEQRES and ATOM records:

>d1k83c2 d.181.1.1 (C:42-172) RPB3 {Baker's yeast (Saccharomyces cerevisiae)}
ptlaidsvevetnttvladefiahrlgliplqsmdieqleysrdcfcedhcdkcsvvltl
qafgesesttnvyskdlvivsnlmgrnighpiiqdkegngvlicklrkgqelkltcvakk
giakehakwgp

Timeline for d1k83c2:

• d1k83c2 first appeared in SCOP 1.59
  
• d1k83c2 appears in SCOP 1.65
  
• d1k83c2 appears in SCOP 1.69
  
• d1k83c2 appears in the current release, SCOPe 2.08