SCOP 1.61: Domain d1jmxa3: 1jmx A:282-363

Lineage for d1jmxa3 (1jmx A:282-363)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.6: Internalin Ig-like domain [68902] (5 proteins)

6. Protein Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 [69176] (2 species)

7. Species Pseudomonas putida [TaxId:303] [69178] (2 PDB entries)

8. Domain d1jmxa3: 1jmx A:282-363 [66903]
   Other proteins in same PDB: d1jmxa1, d1jmxa2, d1jmxa5, d1jmxb_, d1jmxg_

Details for d1jmxa3

PDB Entry: 1jmx, 1.9 Å

PDB Description: crystal structure of a quinohemoprotein amine dehydrogenase from pseudomonas putida

SCOP Domain Sequences for d1jmxa3:

Sequence; same for both SEQRES and ATOM records:

>d1jmxa3 b.1.1.6 (A:282-363) Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 {Pseudomonas putida}
gkarllavqpafikaggeseitlvgsglagkpdlgagvevtevleqtptlvrlkaraaad
akpgqrevavgtlkgvnlavyd

Timeline for d1jmxa3:

• d1jmxa3 first appeared in SCOP 1.59
  
• d1jmxa3 appears in SCOP 1.63
  
• d1jmxa3 appears in the current release, SCOPe 2.08